SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XNT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XNT8
Domain Number 1 Region: 302-531
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-52
Family Kelch motif 0.0002
Further Details:      
 
Weak hits

Sequence:  M3XNT8
Domain Number - Region: 148-220
Classification Level Classification E-value
Superfamily PH domain-like 0.0043
Family TFIIH domain 0.036
Further Details:      
 
Domain Number - Region: 21-81
Classification Level Classification E-value
Superfamily PH domain-like 0.00891
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XNT8
Sequence length 544
Comment (tr|M3XNT8|M3XNT8_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000738} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSVLDALWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWH
SLALPRVNLSIGYNCILSITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRL
FTSVIAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKVNGVWNLSSDQGNLGTF
FITNVRIVWHANMNESFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFV
AYFADGNKLDNITSEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCYDP
VAAKWNEVKKLPIKVYGHSVISHKGMIYCLGGKTDDKKCTNRVFIYNPKKGDWKDLAPMK
IPRSMFGVAVHKGKIVIAGGVTEDGLSASVEAFDLTTNKWEVMTEFPQERSSISLVGLAG
SLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNLFK
LSKL
Download sequence
Identical sequences M3XNT8
ENSMPUP00000000738 ENSMPUP00000000738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]