SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XPR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XPR2
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.41e-40
Family Patatin 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XPR2
Sequence length 253
Comment (tr|M3XPR2|M3XPR2_MUSPF) Patatin like phospholipase domain containing 4 {ECO:0000313|Ensembl:ENSMPUP00000001062} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PNPLA4 OC=Mustelinae; Mustela.
Sequence
MKHINLSFAACGFLGIYHLGAASALCRHGQKLLKAVKAFAGASAGSLVASVLLTAPEKIE
ECNEFTYEFAEETRRQSFGAVTPGYDFMARLRSGMERILPSNAHELAHSRLHVSITNTKT
RENYLVSSFRSREDLIKVLLASSFVPIYAGLKPVEYRGQTWVDGGLTNSLPILPVGRTVT
ISPFSGRLDISPQDKGQLDLYVNLANQDVTLSVANLVRLNQALFPPCKRKMESLYQLGFD
DAIRFLLKENWFE
Download sequence
Identical sequences M3XPR2
ENSMPUP00000001062 ENSMPUP00000001062 XP_004768338.1.14098 XP_004768339.1.14098 XP_004768340.1.14098 XP_012919856.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]