SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XQD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XQD0
Domain Number 1 Region: 420-526
Classification Level Classification E-value
Superfamily Homeodomain-like 8.96e-37
Family SWIRM domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 137-192,232-267
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000353
Family DNA topoisomerase II binding protein 1, TopBP1 0.076
Further Details:      
 
Domain Number 3 Region: 598-649
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000411
Family Homeodomain 0.07
Further Details:      
 
Weak hits

Sequence:  M3XQD0
Domain Number - Region: 194-222
Classification Level Classification E-value
Superfamily Chromo domain-like 0.03
Family Chromo domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XQD0
Sequence length 1120
Comment (tr|M3XQD0|M3XQD0_MUSPF) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 {ECO:0000313|Ensembl:ENSMPUP00000001280} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SMARCC2 OC=Mustelinae; Mustela.
Sequence
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEAAVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKSPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATRE
WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLA
YQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGTDEARAEGQATEEKKEPKEPREGVG
AAEEETKEKTSEVPKKDEERGKQGDSEKESEKSDGDPIVDTEKEKEPKEGQEEVLKDVVE
SEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLE
IKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQLVPPAGTGPPVVHSLAMAPASVAPAPAGGGAPPGSLGPSEQIGQAGSAAG
PQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPAMMPGAVPGSGHPGVAAQSPAIV
AAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ
Download sequence
Identical sequences M3XQD0
ENSMPUP00000001280 ENSMPUP00000001280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]