SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XQE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XQE1
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 1.96e-16
Family PX domain 0.006
Further Details:      
 
Domain Number 2 Region: 203-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000241
Family BAR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XQE1
Sequence length 404
Comment (tr|M3XQE1|M3XQE1_MUSPF) Sorting nexin {ECO:0000256|PIRNR:PIRNR036924} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SNX5 OC=Mustelinae; Mustela.
Sequence
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSEREKVKFTVHTKTTLSTFQN
PEFSVTRQHEDFVWLHDTLIETADYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EVFGGFFKSVVKSADEVLFSGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVESRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALTDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LVNFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Download sequence
Identical sequences M3XQE1
XP_004754236.1.14098 XP_004754237.1.14098 ENSMPUP00000001291 ENSMPUP00000001291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]