SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XQE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XQE5
Domain Number 1 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 332-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-16
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Weak hits

Sequence:  M3XQE5
Domain Number - Region: 62-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00144
Family KRAB domain (Kruppel-associated box) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XQE5
Sequence length 390
Comment (tr|M3XQE5|M3XQE5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000001295} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MAMLTPAQRPWSTDLQPKKALLKRESLGSQASADSVLQVPGLAPGGRCRGHAVVAARLPP
EPQGLLKMEDVALASSLAWTQLDSSWRSFHGEERQENCGGLTPLGGAMQAEIADPPPDEQ
HPGQEPGEVPCPVGEDTAPAPARAEAGEQEGRLPRKQKNDTGPRRHYCHECGKSFAQSSG
LTKHRRIHTGEKPYECEDCGKTFIGSSALVIHQRVHTGEKPYECDECGKVFSHSSNLIKH
QRTHTGEKPYECEDCGKTFSQSCSLLEHHKIHTGEKPYQCSMCGKAFRRNSHLLRHQRIH
GDRNVQDPERAETWESRGRVGGQWENEAPVSHKCHECERSFTRNRSLIEHQKIHTGEKPY
QCDTCGKGFTRTSYLVQHRRSHVGKKVPSQ
Download sequence
Identical sequences M3XQE5
XP_012905162.1.14098 ENSMPUP00000001295 ENSMPUP00000001295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]