SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XQI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XQI6
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XQI6
Sequence length 124
Comment (tr|M3XQI6|M3XQI6_MUSPF) SH2 domain-containing protein 1A {ECO:0000256|PIRNR:PIRNR037828} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SH2D1A OC=Mustelinae; Mustela.
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSETVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKIKNLISAFQKPDQGIVIPLQYPVEKKCSQGATGRREDPDVF
LKAP
Download sequence
Identical sequences M3XQI6 U6DU95
XP_004762078.1.14098 ENSMPUP00000001336 ENSMPUP00000001336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]