SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XQL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XQL1
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000000128
Family Pyk2-associated protein beta ARF-GAP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XQL1
Sequence length 533
Comment (tr|M3XQL1|M3XQL1_MUSPF) ArfGAP with FG repeats 1 {ECO:0000313|Ensembl:ENSMPUP00000001361} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=AGFG1 OC=Mustelinae; Mustela.
Sequence
MTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVP
PEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPALHLNKGTPSQSPVVGRSQV
QQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQS
SGSSNFGGFPTASHSPFQPQTTAFRMLSSSCSFGEFTSAFPLQASNSGSAGSVNANFAHF
DNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTTDKYAALANLDNIFSAGQGGDQ
GSGFGTTGKAPVGSVVSVPTQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVF
GTVPVGASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATGLSGAM
HSQVFPHAHFAATFGTASMSMPAGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQ
QANGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences M3XQL1
ENSMPUP00000001361 ENSMPUP00000001361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]