SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XQL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XQL6
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000196
Family DBL homology domain (DH-domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XQL6
Sequence length 79
Comment (tr|M3XQL6|M3XQL6_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000001366} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MYKQELLKWTPRKHSDHTAVIEALQAMKVVYSNINEAKRQIEKLEVLEEWQSHIEGWELL
QTLEDHLRDDTLAPVTKIS
Download sequence
Identical sequences M3XQL6
ENSMPUP00000001366 ENSMPUP00000001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]