SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XRA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XRA0
Domain Number 1 Region: 175-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-48
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 659-755
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-20
Family PDZ domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 540-615
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1887-1950
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000786
Family SAM (sterile alpha motif) domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XRA0
Sequence length 1954
Comment (tr|M3XRA0|M3XRA0_MUSPF) SH3 and multiple ankyrin repeat domains 1 {ECO:0000313|Ensembl:ENSMPUP00000001600} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SHANK1 OC=Mustelinae; Mustela.
Sequence
MTHSPASSEDEERHSASECPEGGSESDSSPDGPSRGPRGTRGQGSGAPGSLASTRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFAAPGTSSSGAPGPTSGPQGQSQPSAPSTK
LSSGTLRSASSPRGARARSPSRGRHPEEAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQEGKQESRSDKAKRLFRHYTVGSYDSFDAPRSLMDGIGPGSDYII
KEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMG
DFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPP
PAISLRSKSMTSELEEMGLVSPWKKKSEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAA
QQTISASESPGPGGLASLGKHRPKGFFATESSFDPHHRSQPSYERPSYLPPGPGLMLRQK
SIGAAEDDRPYLAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSP
RGGPFNPSSGGPLPSSSPASFDGPSPPDTRVGSREKSLYHXPSPVPTPTSPSGPATLDFT
SQFGAALVGAARREGGWQNEARRRSTLFLSTDAGDEDGGDSGLGPGAPPGPRLRHSKSID
EGMFSAEPYLRLESAGAGSGGGYGAYAAGSRAYGGSGGSSAFTSFLPPRPLVHPLTGKAL
DPASPLGLALAARERALKESSEGGGPPQPPPRPPSPRYEAPPPTPHHHSPHAHHEPVLRL
WGASPPDPARRELGYRAGLGSQEKSLPASPPAARRSLLHRLPPTAPGVGPLLLQLGPEPP
PPLPGVNKAWRSGAPEEPERLPLHVRFLENCQPRASGAGGRGPPSEDGPGVPPPSPRRSV
PPSPTSPRGTEENGLPLLVLPPPAPSVDVEDGEFLFVEPLPPPLEFSNSFEKPESPLTPG
PPHPLPDPPTPTTPLPPVPPPAVAAAPPTLDSTASSLTSYDSEVATLTQGAPVAPGDPPP
PGPPAPAAPAPPAPQPGPDPPPGTDSGIEEVDSRSSSDHPLETISSASTLSSLSAEGGGP
AGGGGGGGGASVASGPELLDTYVAYLDGQAFGGSGTPGPPYPPQLMTPSKLRGRALGTSG
GLRPGPSGGLRDPVTPTSPTVSVTGAGTDGLLALSGCTGPSTAGMAGGPVAIEPEGPPVP
LPSASSLPRKLLPWEEGPGPPPPPLPGPLAQPQASALATVKASIISELSSKLQQFGGSSA
AGGALPWARGGSGGSGDSHHGGSSYVPERTSSLQRQRLSEDSQSSLLSKPVSSLFQNWPK
PPLPPLPTGSGVPPSAAAASGATSPSASSSTSTRHLQGVEFEMRPPLLRRAPSPSLLPAS
EHKVSPAPRPSSLPILPSGPLYPGLFDIRSSPTGGAGGSADPFAPVFVPPHPGMSGGLGG
ALSGASRSLSPTRLLSLPPDKPFGAKPLGFWTKFDVADWLEWLGLAEHRAQFLDHEIDGS
HLPALTKEDYVDLGVTRVGHRMNIDRALKFFLER
Download sequence
Identical sequences M3XRA0
ENSMPUP00000001600 ENSMPUP00000001600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]