SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XRZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XRZ9
Domain Number 1 Region: 115-341
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.04e-45
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 570-666
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-17
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 3 Region: 473-537
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1653-1709
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000557
Family SAM (sterile alpha motif) domain 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XRZ9
Sequence length 1712
Comment (tr|M3XRZ9|M3XRZ9_MUSPF) SH3 and multiple ankyrin repeat domains 3 {ECO:0000313|Ensembl:ENSMPUP00000001849} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SHANK3 OC=Mustelinae; Mustela.
Sequence
LEGPGFTALGVVVRVNHDPAPPQKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQP
PSRGRAGKFLDEERLLQEYPPNLDTPLPYLEQFRYKRRVYAQNLIDDKQFAKLHTKANLK
KFMDYVQLHSTDRVARLLDKGLDPNFHDPDSGECPLSLAAQLDNATDLLKVLRNGGAHLD
FRTRDGLTAVHCATRQRNAAALTTLLDLGASPDYKDSRGLTPLYHSALGGGDALCCELLL
HDHAQLGTTDENGWQEIHQACRFGHVQHLEHLLFYGADMGAQNASGNTALHICALYNQES
CARVLLFRGANKDVRNYNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYAKRRR
LAGPSGLASPRPLQRSASDINLKGEVQPAASPGPSLRSLPHQLLLQRLQEEKDRDRDGDQ
ENDIGGPTAGRGSQRKIRELFPSGNLPEPGKGGSLPTPPASEQREGGGLRASASVPSRKF
IAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDTR
HETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIE
EFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNR
LVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDE
ILAAAAEPALRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKLPGSLRKG
IPRTKSVGEDEKLASLLEGRFPRSTSMQDPVREGRGIPPPPQTAPPPPPAPYYFDSGPPP
AFSPPPPPGRAYDTVRSSFKPGLEARLGAGAAGLYDPGAPLGPLPYPERQKRARSMIILQ
DSAPEMGDVPRPPPAATPPERPKRRPRPPGPDSPYANLGAFSASIFAPSKPQRRKSPLVK
QLQVEDAQERAALAVGSPGPTGGSFAREPSPTHRGPRPSGLDYGLADSPGLAFGGPGPSK
DRRLEERRRSTVFLSVGAIEGSPPSADLPSLQPSRSIDERLLGTGPTAGRDLLLPSPVSA
LKPLVSGPSLGPSGSTFIHPLTGKPLDPSSPLALALAARERALASQAPSRSPTPVHSPDA
DRPGPLFVDVQARDSERGALASPAFSPRSPAWVPVPARREPEKAPREERKSPEDKKSMIL
SVLDTSLQRPAGLIVVHATSNGQEPSGLAAEEERPGTPELAPTPTQSAVVAEPLASPRAQ
PPGSAPPSEPGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANG
VLLATPLPGPGPSPTTVPGPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTI
STVSSMSTLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQ
SSDSELMAQQHHAASAGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPAVISE
LSSRLQQLNKDTRSLGEEPAGGLGGLLDPAKKSPIAAARLFSSLGELSTISAQRSPGGPG
GGASYPVRPGGRYPVARRAPSPVKPASLERVEGLGRPFGLTPPTILKSSSLSIPHEPKEV
RFVVRSVSARSRSPSPSPLPSPAPGPGPXSKFDVGDWLESIHLGEHRDRFEDHEIEGAHL
PALTKDDFVELGVTRVGHRMNIERALRQLDGS
Download sequence
Identical sequences M3XRZ9
ENSMPUP00000001849 ENSMPUP00000001849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]