SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XS35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XS35
Domain Number 1 Region: 301-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-51
Family SPRY domain 0.0000491
Further Details:      
 
Domain Number 2 Region: 16-89
Classification Level Classification E-value
Superfamily RING/U-box 6.03e-21
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 104-165
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000534
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XS35
Sequence length 485
Comment (tr|M3XS35|M3XS35_MUSPF) Tripartite motif containing 75, pseudogene {ECO:0000313|Ensembl:ENSMPUP00000001885} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRIM75P OC=Mustelinae; Mustela.
Sequence
RKPTSVQVFIHSPMAVPAALAGLQAEANCPVCLDYLRDPVTTECGHNFCRCCIQQSWADL
KDRFPCPVCRHTCQERHLRSNTQLGRMIDIAKLLHITRTKKRRPEEKHLCEKHNQVLTLF
CEEDLEVLCPTCTQPPDHQGHLVRPMVEAASHHRQRLSRYIEPLKKQMENVQKLINIQSK
KPLELKEKVENQRQELLSEFECLKQFLDRDQEAVLLRLADEEKDIQQKLSANITAFSNYI
SVLRGLLSKVVENSVLSEVELLSQIKNFYRRSEDEISPSIFSIQLRREGCSFPPQYSALQ
KIINKFRVDIILDHETAHPNLIVSEDKKYVTFSKRKQNVPHFPKRFTANTVVLGFPYFYS
GRHYWEVEVGDKSEWAVGICKDSLPPKARRSSQAWQGCWVIQRQEDRYEVVGATATVLLL
AVNPRGIGIFLDYELGEISFYNRTEKSHIYTFTDTFTRPLSTQFEGVGGRHQREPLTYQC
LTAFP
Download sequence
Identical sequences M3XS35
ENSMPUP00000001885 ENSMPUP00000001885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]