SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XS57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XS57
Domain Number 1 Region: 45-232
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-50
Family DBL homology domain (DH-domain) 0.0000119
Further Details:      
 
Domain Number 2 Region: 240-366
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-29
Family Pleckstrin-homology domain (PH domain) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XS57
Sequence length 474
Comment (tr|M3XS57|M3XS57_MUSPF) Rho guanine nucleotide exchange factor 25 {ECO:0000313|Ensembl:ENSMPUP00000001907} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGEF25 OC=Mustelinae; Mustela.
Sequence
MLEPALTTGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYVLS
ELVETEKMYVEDLGQIVEGYMATMAAQGVPESLRGRDRIVFGNVQQIYEWHRDYFLEELQ
RCLNDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGHRLQLSD
LLIKPVQRIMKYQLLLKDFLKYYSRAGMDTEELEQAVEVMCFVPKRCNDMMTLGRLRGFE
GKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRVFLFEQIVIFSEALGGGVRGGSQAGY
VYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQRYVLQSADPAVSQAWIKQVAQILE
SQRDFLNALQSPIEYQRRESQTNSLGRPGGLGVGSPGRIRPGDRAQVSTHTPINGSLPSL
RLLPKGEVARAPLPLDTQAHSDIPRAPHDSPPAPPIPDTPPCQARLAKLDEDEL
Download sequence
Identical sequences M3XS57
ENSMPUP00000001907 ENSMPUP00000001907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]