SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XSA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XSA6
Domain Number 1 Region: 30-162
Classification Level Classification E-value
Superfamily ENTH/VHS domain 6.41e-30
Family RPR domain (SMART 00582 ) 0.006
Further Details:      
 
Domain Number 2 Region: 440-569
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-18
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XSA6
Sequence length 1290
Comment (tr|M3XSA6|M3XSA6_MUSPF) SR-related CTD associated factor 8 {ECO:0000313|Ensembl:ENSMPUP00000001956} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SCAF8 OC=Mustelinae; Mustela.
Sequence
MEAVKTFNSEDCASTPACTDCFSSSMDTRSILYSLNDYKPPISKAKMTQITKAAIKAIKF
YKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNL
YRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAGIPPPVVTPVLASTTAAMSNTPG
TPVTPVTPANVVQGLPDPWVSQITNTDTLAAVAQILQSPQGQQLQQLIQTLQLQQQKPQP
SILQALDAGLVVQLQALTAQLTAAAAAANTLNPLEQGVAFNKLMDRFDFGEDSEHSEEPK
KEISASQLSHVSESVNNSIFHQIAEQLQQQNLEHLRQQLLEQQQPQKATPQDSQEGTFGS
EHSASPSQGSSQQHFLEPEANLDDSIDIQQQDMDIDEGQDGVEEEIFEQEAKKVAVRSRS
RTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSRSRERKRKSSRSYSSERRAREREKERQ
KKGLPPVRSKTLSVCSTTLWVGQVDKKATQQDLTNLFEEFGQIESINMIPPRGCAYVCMV
HRQDAFRALQKLSSGSYKIGSKVIKIAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDD
LEGFAEGGMIDQETVNTEWETVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVFPPPVAM
LQIPVAPAVPAVSLVPPAFPVSMPVPPPGFSPIPPPPFLRASFNPSQPPPGFMPPPVPPP
VVPPPTIPPVVPTSLVQPPLSMTPETVKDVGFGGLVLPGGSVASNLATSTLPAGNVFNPP
TKQGEPEEKVPHLIDHQIPSGENTRSVIPNDIPSSPAMLGGQPPNVTSNSGILGVQRPNV
SSNSEIIGIRPSNVSSSSGMIGAQPPNILNNSGILGLQPPTVSSSSGLLGVLPPNIPNNS
GLIGVQPPNVPNAAGLLGTQPPAGPQNLPPLNLSNQRMPAMPMLDIRPGLMPQTPGPRFP
LIQPGIPPQRGIPPPSVLDSPLHPPPRGPFPPGDIFSQPERPFLVPGRQSVDNVTNPEKR
IPLGNDNIQQEGDRDYRFPPIEARESISRPPPVDVREVVGRPIDPREGPGRPPLDGRDHF
GRPPVDIRENLVRPGIDHLGRRDHFGFNPEKPWGHRDFDEREHRVLPVYGGPKGLHEERG
RFRSGSYRFDPRSGPWNRGFGQEVHRDFDDRRRPWERQRDRDDRDFDFCREINGNRLGRD
RIQNTWVPPPHPRVFDFFEGATSQRKGDNVPQVNGENTERHAQPPPLPVQNDPELYEKLT
SSSEINKEKSDTVADIESEPVVESTETEGT
Download sequence
Identical sequences M3XSA6
XP_012904251.1.14098 ENSMPUP00000001956 ENSMPUP00000001956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]