SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XSE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XSE1
Domain Number 1 Region: 190-334
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-38
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.72e-26
Family First domain of FERM 0.00056
Further Details:      
 
Domain Number 3 Region: 77-192
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-19
Family Second domain of FERM 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XSE1
Sequence length 569
Comment (tr|M3XSE1|M3XSE1_MUSPF) FERM domain containing 3 {ECO:0000313|Ensembl:ENSMPUP00000001991} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FRMD3 OC=Mustelinae; Mustela.
Sequence
MKCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNK
SISKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYL
GACIVQDELSDYYIKDPLEHPKNQTPEKLIYPRPLQNLTKAAIELHKCDSRGQSPPVAEF
NLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEG
KTFYVIGIQKEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKG
SRFRYSGKVAKEVVEASSKIQREPPEVHRTSMTQSRSSYSLNKQLIINMEPLKPLLPSPN
EQEEELLLGEGVPLPKEDVSAPLISSSPVKEAREYENPPNEEEEDKIKEEPLTISELAYN
PSASLLPTPVDDDEIDMLFDCTSRLELEREDTDSFEELEADEHAFLMAEEEELKEAHQAL
SWSYDILRGHIRVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLCEIRQTPEF
EQFHYEYYCPLKEWLAGKVNLILYMLGCS
Download sequence
Identical sequences M3XSE1
ENSMPUP00000001991 ENSMPUP00000001991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]