SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XSE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XSE8
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000169
Family LASP-1 0.016
Further Details:      
 
Weak hits

Sequence:  M3XSE8
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0402
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XSE8
Sequence length 1728
Comment (tr|M3XSE8|M3XSE8_MUSPF) Nebulin related anchoring protein {ECO:0000313|Ensembl:ENSMPUP00000001998} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NRAP OC=Mustelinae; Mustela.
Sequence
MNVQACSRCGYGVYPAEKISCLDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNMRKSSEASHGIDDQDEGGQFKSVFHWDMKSRDGTAAPNGQPPMNE
RAYWTGYGEGNAWCPGDLPDPEIVRMVEARKSLGEEYTEDYEQQRGKGSFPAMITPAYQR
AKKANQLASQVEYKRGHDERVSRFTTVADTPELLRAKAGGQLQSDVRYMEDYEQQRGKGS
FPAMITPAYQIAKRANELASDVRYHQQYQREMKGMASSAAGAAGTRECMDQYGQGYLEDY
QEHRGKGSFPAMITPAYQNAKKANELASDIKYRQDFNKMKGPAHYHSLPAQDNLVLKQAQ
SVNKLVSEVEYKKDLENSKGHSINYCETPQFRNVSKISKFTSDNKYKENYQNHMRGHYEG
VGMDRRTLHAMKVGSLASNIAYKADYKHDVVDYNYPATLTPSYQTTMKLVPLKDVNYRQS
IDKLKYSSVTNTPQIIQAKINAQQLSHVNYRADYEKNKLNYTLPQDVPHLVKAKTNAELF
SEVKYKEGWEKAKGKGFEMKLDAISLLAAKASGELASNIKYKEEYEKMKGKVMGTTDSRL
LHSLQVAKMSSEVEYKKGFEESKTHFHLPMDMVHIKHAKKAQALASDLDYRTKLHEYTVL
PEDMKTQWAKKAYGLQSELQYKADLAWMKGAGWLTEGSLNLEQAKKAGELVSEKNYRQRV
DKLKFTSVADSSQMEHARRSQELQSGVAYKAGNEQSVHQYSISKDEPLFLQARANAANLS
EKLYKSSWENQKAKGFELRLDSLGFLAAKANRDLASEVKYKEDYERSRGKLIGAKDARGD
SQMSHSLQMSKLQSELEYKKGFEDTRSQCHVSLDMIHLAHARKAQHLATDIGYKTASYQF
TALPTDMKVEWAKKAYDLQSDNRYRADVRWMKGAGWVATGSLNVEQAKKAGALISEKKYR
QHPGALKFTSIKDTPEMVQARISYTQAVDRLYREQGENIKHHYTQTADLPEVLLAKLNAM
NISETRYKESWSKLRDGGYKLRLDAIPFQAAKASGEIISDYKYKEAFEKMKGQMLGSRSL
EDDLSLAHSAYANSLQSQVNYKKGFELSKAHFHLPLDMVTLVHAKKAQVLASDQDYRHPL
PQYTSLAEDLRLSCAKKAHKLQSENLYRSDLNFMRGVPCVIPGTLEIEGRKKASELISES
KYRQHPQSFKYTAVTDTPSLLHAKLSNQITNERLYKAAGADEMHRYTLTLGLPELVRAKA
NAANLSDAKYQESWRNLRAQGYKLTIDALPFQAARVSGDRASDFLYRHDFVKERGRLIGV
RSVSDDPRLQHCWRVGQLQSELQYRRTAASSHDQFHLPLDMVHLVHARKAQALASDHDYR
TRCHEFTALPEDLKMSWAKRAHALQSEFRYKSDLMGMKGTGWLTVSSPQLESAKKAGELI
SETKYRKKPDSIKFTTVVDSPDLVHAKNSYLHCNERLYKLGDAESLHRYTPIPDHPDFAR
ARLNALHLSDKAYRSSWEQTRAGGYDFRLDAIPFQTARASREIASDFRYKEAFLRDRGLQ
IGYRSVNDDPRMRHFLSVGKLQSDNEYKKDFAKSRSQFHSRPDQPGFIQARRSQQLASDT
GYRQPLPQPTCDPEQLGLKHAQKAHQLQSDVKYKSDLNLTRGIGWTPPGSYKVEMARRAA
ELAKARGPSLRGASGGPEAVGPTDNQRGDVNPDAMEILHVNRRKVLSL
Download sequence
Identical sequences M3XSE8
ENSMPUP00000001998 ENSMPUP00000001998 XP_004763891.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]