SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XT62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XT62
Domain Number 1 Region: 144-415
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-42
Family Tandem AAA-ATPase domain 0.036
Further Details:      
 
Domain Number 2 Region: 696-780
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000827
Family Tudor domain 0.0056
Further Details:      
 
Domain Number 3 Region: 2-85
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000136
Family Tandem AAA-ATPase domain 0.044
Further Details:      
 
Weak hits

Sequence:  M3XT62
Domain Number - Region: 541-589
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00271
Family Canonical RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XT62
Sequence length 1153
Comment (tr|M3XT62|M3XT62_MUSPF) Tudor domain containing 9 {ECO:0000313|Ensembl:ENSMPUP00000002262} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TDRD9 OC=Mustelinae; Mustela.
Sequence
MTTGVLLQKIVSAKSLMEFTHVFIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVILMSAT
INCKEFADYFAVPVQNKMNPAYIFEVEGKPHSIEEYYLDDLGHAYHGRLPPCVLEEPVIT
KDIYEVAISLIQMFDDLDMKERGSKTWSGAQFVLERSSVLVFLPGLGEINYMHELLTNMV
HKRLQVYPLHSSVTLEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTL
VCDEDTNYQSLRLSWASKTSCDQRKGRAGRVSKGYCYRLIHKDFWDSSIPDHVVPEMLRC
PLGSTILKVKLLDMGEPRALLATALSPPSLSDIERTILLLKEVGALAVSGQREGENPHDG
ELTFLGRVLAQLPVNQQLGKLIVLGHVFGCLDECLIIAAALSLKNFFAMPFRQHLDGYRN
KVNFSGNSKSDCIALVEAFKTWRTCRQSGELRHPKDELDWGRLNYIQIKRIREVAELYEE
LKNRVSQFNMHVEPRRPVMDQEYTYKQRFILQVVLAGAFYPNYFAFGQPDEEMAVRELAG
KDPKTTVVLKHIPPYGFLYYKQLQSLFRQCGQVRSIVFDGAKAFVEFSRNPTERFKTLPA
VYMAIKMSQLKVSLELNVHSAEEIEGKVQGGAVSKLRSTRVNVDFQKQTVDPMQVSFNAL
DRSRTITDLLLTVDVTEVVEVGHFWGYRIDEKNSGILRKLTAEINRLDLLPLPVRPHPDL
VCLAPFADSDKESYFRAQILYVSGNSAEVFFVDYGNRCRVDLDLLMEMPCHLLELPFQAL
EFKICKMRPSAKSLVCGEHWSGAASRRFASLVSGCALLVRVFSVVHSVLHVDAYRYAGAQ
DAVSVRDVLIKEGYAELSEEPYESKQSHEALKVLFPTPVDNMAELSPSSPVKDDEKYLIR
ALLESFSSNKLGTPNCKALLHGPFNPYELKCHSLTRISKFRCVWVEKESINSVIISDAPE
DLHQRILVAASLSVNATGSTMLLRETSLLPHVPGLPALLSALFAPVIELRVDREGKCYTG
VLCGLGWNPTTGAPILPEHDIELAFDVQLSVEDIVEINILRAAINKLVCDGPNGSKFLGP
ERIAQLQDNARQKLLGLFCQLKPRQRIVPKWHEKPYEWNQVDPKLVMEQADRESGRGKNT
FLYQLHRLVVLST
Download sequence
Identical sequences M3XT62
ENSMPUP00000002262 XP_012912803.1.14098 ENSMPUP00000002262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]