SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XT79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XT79
Domain Number 1 Region: 28-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.99e-25
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 2 Region: 917-1040
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-24
Family Ankyrin repeat 0.000000728
Further Details:      
 
Domain Number 3 Region: 1045-1107
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XT79
Sequence length 1116
Comment (tr|M3XT79|M3XT79_MUSPF) Protein phosphatase 1 regulatory subunit 13B {ECO:0000313|Ensembl:ENSMPUP00000002279} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PPP1R13B OC=Mustelinae; Mustela.
Sequence
MAICKERDLRRTQPCLHLDLGLPAPRMMILTVFLSNNEQILTEVPITPETTCRDVVEFCK
EPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWGPRREEVKFFLRHEDSPTESIEQGGRQ
TQEQRTQRNVINVPAEKRTENGVGSARVELTLSELQDMAARQQQQIENQQQMLVAKEQRL
HFLKQQERRQQQSISENEKLQKLKERVEAQENKLKKIRAMRGQVDYSKIMNGNLSAEIER
FSAMFQEKKQEVQTAILRVDQLSQQLEDLKRGKLSGLPAYSGRLAGPAAAELKRLCQELQ
IRNQLNQEQTSKLQQQKELLNKRNMEVAVMDKRISELRERLYGKKIQLSRVNGTSSPQSP
LGTPGRVAAVGPYIQVPSAGSYSVPGDPIKPQSLTIASSAAHGRSKSANDGNWPALKQNS
SSSAKPTQVAGADWKDSSVEGPLKQGAVSSQPAPLSTLGATEKLGMEMGKVPPPIPGVGK
QPPPSYGTYPSPAPVGPGSTNSLERRKEGSLPRPSAGLPGRQKPGPLPPAVTGPPPGTSQ
QIQQRISVPPSPTYPPVGLPAFPAGDSKPDLPLTVAIRPFLADKGSRPQSPRKGPQTVNS
SSIYSMYLQQATPPKNYQPAAHSTLNKSVKAVYGKPVLPSGSTSPSPLPFLHGSSATSTS
QSQPPSDSAEKEPEQDSPAPPGDGSAGTGAVESLPRPLSPTKLTPIVHSPLRYQSDADLE
ALRRKLANAPRPLKKRSSITEPEGPGGPNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFM
GTLADVDNGNATNGNLGEASPAQPTAPPLAEPAPSSDANDNELLSPEPEGLICPQSTRQT
TEPAEDDNNNVATAPPTEQVPSPGAEAPSPGEDQAPPALPPAMPPPGASTSKRTNLKKPN
SERTGHGLRVRFNPLALLLDASLEGEFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHH
HIVRFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKQLVESGAAIFASTISDIETAADK
CEEMEEGYMQCSQFLYGVQEKLGVMNKGVVYALWGYEAQNSDELSFHEGDAITVLRRKDE
SETEWWWARLGDREGYVPRNLLGLYPRIKPRQRTLA
Download sequence
Identical sequences M3XT79
ENSMPUP00000002279 ENSMPUP00000002279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]