SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XT85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XT85
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000384
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XT85
Sequence length 207
Comment (tr|M3XT85|M3XT85_MUSPF) Zinc finger FYVE-type containing 21 {ECO:0000313|Ensembl:ENSMPUP00000002285} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZFYVE21 OC=Mustelinae; Mustela.
Sequence
QCPRCMQCDAKFDFLTRKHHCRRCGKCFCDKCCGQKVPLRRMCFVDPVRQCAECALVSHK
EAEFYDKQLKVLLSGATFLVTLGDAEKPETMVCRLSGNQRYLLLEGDSRHEIEITRISAV
QVLTEGFQAGEKDSHAYTSLLGSQPVSEGGNARATGMSLQYTAPGAEGTTQLKLTAGEDA
SASRRQSTAWLVAMHKATKLLYESRDQ
Download sequence
Identical sequences M3XT85
ENSMPUP00000002285 ENSMPUP00000002285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]