SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XTC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XTC5
Domain Number 1 Region: 106-184
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-16
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 2 Region: 184-280
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000021
Family PDZ domain 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XTC5
Sequence length 287
Comment (tr|M3XTC5|M3XTC5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000002325} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSLYPSLENVKVDKVIQAQNAFSANPGNPAILSEASAPISQDGNLYPKLYPELSQYMDLS
LNEEEIHANMAVVPGAPVQGHFNMNYMVAPVTGNDVGIRRAEIKRRIREDQDGKIGLRLK
SIDNDIFAQLVQENSLASLVGLRFGDQVLQINGENCAGWSSDKAQKVLKQAFGEKITMTV
CDPFEQTVTMHKDSTGHVGFIFKNGKITSIRKDSPAARNGLLTEHNICEVNGQYVIGLKD
SPTADILSISETAVTITIMPAFIFEHIIKWMAPSIMKSLMDHIIPEV
Download sequence
Identical sequences M3XTC5
ENSMPUP00000002325 ENSMPUP00000002325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]