SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XTF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XTF1
Domain Number 1 Region: 610-814
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-36
Family DBL homology domain (DH-domain) 0.00000425
Further Details:      
 
Domain Number 2 Region: 827-953
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-27
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 3 Region: 318-424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000262
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 41-192
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000209
Family CRAL/TRIO domain 0.011
Further Details:      
 
Weak hits

Sequence:  M3XTF1
Domain Number - Region: 430-523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.036
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XTF1
Sequence length 1037
Comment (tr|M3XTF1|M3XTF1_MUSPF) MCF.2 cell line derived transforming sequence-like 2 {ECO:0000313|Ensembl:ENSMPUP00000002351} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MCF2L2 OC=Mustelinae; Mustela.
Sequence
MRFWLQEEMAPQELSRRLATVITHVDEIMQQEIRPLVAVDIIEQLHRQFAILSGGRGKDG
APIITFPEFVGFKHLPEEDFLNVMTYLTSIPSVEAASIGFIIVIDRRRDKWSSIKASLTR
IAVAFPGNLQLIFILRPSRFIQRTFTDIGIKYYREEFKMKVPIVMLNSVSDLHGYIDKSQ
LTEDLGGTLEYHHSQWINHRTAIENFAMSLKTTAEMLQMFGACLATKELPSSVLSAEDLL
MSHTRRRDKLQDELKLLGKQGTTLLSCIQEPATKSPSSKLNPSELENVATMERLLLQLDE
TERAFNQFWSEHHLKLNQCLQLQHFERNFYEVKLALDSLLAEQVEFTDIGDSVICVEQLL
KEHKNLEEKGQDTLEKAKLLSIIGDQLIQSHHYAVDSIRPRCVELRHLCDDFINENKKKY
DILEKSLELHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDVALNDIEAFLSTAKEYQL
PSHMEFYNQFELILTIDVKARAQEVLQKLSDVQEIFHKRQMSLMKLAARQTRPVQPVAPH
PESSPKWVSPKTSHPCILAPLQRTSEETYAGTLEKEDDKTKFEVKNEEILESSHDGENPK
PEQLDSPENLSPTRRIIHDLLETEEIYIKEIKSIIDGYLTPMDFIWLKHLIPDVLQNNKE
FLFGNIRELYEFHNRTFLKELEKCTENPELLARCFLKRKEDLQIYFKYHKNLPRARTIWQ
ECQDCTFFGVCQRQLDHELPLFKYLRGPSQRLLKYQMLLKGLLDFESPEDLGIDPGDQEE
GLAKNGPKRTKDSTFSAELQQALAMLEDLIKSCELAMDLAAVTGCPDDIKKLGKLLMHGS
FNVWTVHKDRYKMKDFIRFKPSQRQIYLFERGIVFCKIRMEPSDQGLAPHYSFKKSMKLV
TLSIRQLGRGSSRKFEIAHRNGPEKYILQAASKEIRDCWFSEISKLLMEQQNSIKDIDEG
EGNGKRISSKGCSSREFISMETSEEPEGAEEMEKENSALSLSGLFQLDDSYESCSSKSVP
EMGESIQGKKEGGDEDM
Download sequence
Identical sequences M3XTF1
XP_004745556.2.14098 ENSMPUP00000002351 ENSMPUP00000002351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]