SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XTY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XTY8
Domain Number 1 Region: 531-827
Classification Level Classification E-value
Superfamily L domain-like 1.87e-41
Family Ngr ectodomain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 93-479
Classification Level Classification E-value
Superfamily L domain-like 3.81e-39
Family Ngr ectodomain-like 0.0021
Further Details:      
 
Domain Number 3 Region: 916-1068
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.16e-35
Family Toll/Interleukin receptor TIR domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XTY8
Sequence length 1087
Comment (tr|M3XTY8|M3XTY8_MUSPF) Toll like receptor 8 {ECO:0000313|Ensembl:ENSMPUP00000002538} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TLR8 OC=Mustelinae; Mustela.
Sequence
MPGSAGGKAAEFRKLASFFALSTPSNRGEPSLVLQVTDEKLGRQSLENMTLPSLFLTCLF
LLISDSYEFFNKANYSRSYPCDEKRQNGSVIAECNGRRLREVPQTVGKYVTALDLSDNYI
THITNESFQGLQNLTKINLNHNSNPQHLNENPDINKKGMNITDGAFLNLQNLKQLLLEDN
QLYQVPGGLPGSLKELSLIKNNIISVTKKNTSGLTNLERLYLSWNCYFGNNCVNKTFHIE
NGTFESLTNLQVLSLSFNKLICVPPKLPDSLRELYLSNAKIKSIKQEDFKGLRHLRVLDL
SGNCPRCFNAPFPCTPCEGGSSIQIHPLAFQNLTELRYLNLSSTSLRKIPVTWFENMPRL
KVLHLEFNYLVDEIASGEFLMKLPSLEILDLSFNYKMAKYPKYINISQNFSNLKLLQALH
LRGYVFQELTAKNFHPLKGLPHLRTINLGINFIKQINFTLFQDFPNLTIIYLSENRISPL
VNDIQQNDENGYSSPSHVLKPRSADFEFDPHSNFYHNTHPLIKPQCTAYGKALDLSLNSI
FFIGREQFEAFHDIACLNLSSNGNGQVLNGTEFSAVPHIKYLDLTNNRLDFDDDNALSDL
PELEVLDLSYNAHYFRIAGVTHRLGFIQNLTQLKVLNLSHNGIYTLTEQDLRSMSLEELI
FRGNHLDILWNAEGDKYWKIFTSLRNLTRLDLSLNNLHLIPNEAFLNLPQSLTQLYINNN
MLNFFNWTLLQHFPHLHLLDLSGNRLSSLTNSLSKFTPSLRTLLLRRNRISHLPSNFLSE
ASGLIHLDLSSNLLKMINKSTLQTKTNTSLTILKLDRNPFDCTCDIGDFRRWMDENLDVT
IPRLTDVICSSPGDQKGKSIMSLELTTCISDTIAAVLCFFTSLITITMMLAALGHHWFYW
DVWFIYHVCLAKVKGYRSLSTSQTFYDAYVSYDTKDASVTDWVINELRFHLEESEGKNVL
LCLEERDWDPGLAIIDNLMQSINQSKKTIFVLTKEYAQNWNFKTAFYLALQRLMEENMDV
IVFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQSLKNVVLTENNSRYNNLY
VDSIKQY
Download sequence
Identical sequences M3XTY8
ENSMPUP00000002538 ENSMPUP00000002538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]