SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XTZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XTZ2
Domain Number 1 Region: 399-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-27
Family MAM domain 0.00081
Further Details:      
 
Domain Number 2 Region: 49-207
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000126
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 138-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XTZ2
Sequence length 552
Comment (tr|M3XTZ2|M3XTZ2_MUSPF) EGF like domain multiple 6 {ECO:0000313|Ensembl:ENSMPUP00000002542} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=EGFL6 OC=Mustelinae; Mustela.
Sequence
MPPHWALALPLLFPWVAGGLGNAASPKDHGLSPPALQPGVCRYGTKLACCYGWRRNSKEV
CEATCERGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGVKPRPCQHRCVNTHGSYKCFC
LSGHVLMPDATCANSRTCAMVSCQYACEDTEEGPRCLCPSPGLRLAPNGRVCTDIDECAS
GKAVCPYNRRCVNTFGSYYCKCHVGFELKYTRGRYDCVDINECAMNTHTCSLYANCLNSQ
GSFKCKCKQGYKGNGLQCSVIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNVI
TEPSGTPAPKVNLRPLNSEETVSRARNSNGGKKQKDGRKKEGLEDEEKNEKALKNHIEWE
QSLRGDVFSPKVNEAGGLGLVLVDGKLTSRLEHKDLNISVDCSFDHGVCDWKQDIEDDFD
WNPADRDNAVGYYMAVPAVAGRRDIGRLKLLLRDLQPQSNFCLLFDYRLAGEKVGKLRVF
VKDSNNILAWEETGSEDERWKTGTVPLYQGIATTKSVIFEAERGKGKRGEIAVDGVVLLS
GLCPDDLLSATG
Download sequence
Identical sequences M3XTZ2
XP_004758898.1.14098 ENSMPUP00000002542 ENSMPUP00000002542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]