SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XU42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XU42
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-38
Family CRAL/TRIO domain 0.0024
Further Details:      
 
Domain Number 2 Region: 318-456
Classification Level Classification E-value
Superfamily PapD-like 2.59e-37
Family MSP-like 0.000000237
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000327
Family CRAL/TRIO N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XU42
Sequence length 518
Comment (tr|M3XU42|M3XU42_MUSPF) Motile sperm domain containing 2 {ECO:0000313|Ensembl:ENSMPUP00000002592} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MOSPD2 OC=Mustelinae; Mustela.
Sequence
MTEYHAQNKAKLISETRRRFEAEYVTDKPDKYDPRDVERLQQDDNWVESYLVWRHNIVDE
TLKMLDESFQWRKEMCVNDLTESSIPRWLLEIGGIYLHGYDKEGNKLFWIRVKYHVKDHK
TMLDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KMVIFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKSDIQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPIASEDEASSKEDLESDGKETLETVSNEEQTTLLKKINLTEHT
SKAEENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHIVESSKPTTLTLKDGALAMSDKTSEDLYLQLNRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVISFFYLLYS
Download sequence
Identical sequences M3XU42
XP_004758932.1.14098 ENSMPUP00000002592 ENSMPUP00000002592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]