SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XUB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XUB0
Domain Number 1 Region: 165-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-16
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000321
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  M3XUB0
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0111
Family LIM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XUB0
Sequence length 402
Comment (tr|M3XUB0|M3XUB0_MUSPF) LIM homeobox 5 {ECO:0000313|Ensembl:ENSMPUP00000002660} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LHX5 OC=Mustelinae; Mustela.
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSPSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGGNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGA
LHPLPGEVFSGGPSPPFPMSGASGYSGPLSHPNPELNEAAVW
Download sequence
Identical sequences M3XUB0
ENSMPUP00000002660 ENSMPUP00000002660 XP_004753350.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]