SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XUD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XUD1
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 474-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 157-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XUD1
Sequence length 531
Comment (tr|M3XUD1|M3XUD1_MUSPF) Zinc finger protein 26 {ECO:0000313|Ensembl:ENSMPUP00000002681} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZNF26 OC=Mustelinae; Mustela.
Sequence
MGCILFQELLSFKDISMEFTWEEWQLLDSTQKYLYRDVILENYSHLVSLGYHGTKPDLIF
KLEQGEEPWIINARVSRPSCPEGWKEWGQENEDEFEYVERSFACAAFGRRRLSRTRVPSG
QRIHKYSTHGRRLTQSSASAKSCLRKNPDKFHGYEESYFLKHQRAHSIEKNCVCNECGKA
FRCRSQLIVHLRIHTGERPYECTKCERAFSAKSNLNAHQRVHTGEKPYSCGECGKVFSFR
SQLIVHQEVHTGGKPYGCSECGKAYSWKSQLLLHQRSHTGVKPYECGECGKAFSLKSPFV
VHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKAFNMKTQLVVHQG
IHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCGECGKAFSSKSYLVIHRRTHTG
ERPYECSFCERAFCGKSQLIIHQRTHSTEKPYECSECEKAYPRKASLQIHQKTHSGEKPF
KCGECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
Download sequence
Identical sequences M3XUD1
ENSMPUP00000002681 ENSMPUP00000002681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]