SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XUH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XUH8
Domain Number 1 Region: 311-478,558-728
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.09e-126
Family Mammalian PLC 0.000000669
Further Details:      
 
Domain Number 2 Region: 153-310
Classification Level Classification E-value
Superfamily EF-hand 6.71e-45
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 
Domain Number 3 Region: 746-862
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.84e-28
Family PLC-like (P variant) 0.00068
Further Details:      
 
Domain Number 4 Region: 27-139
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-25
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XUH8
Sequence length 1684
Comment (tr|M3XUH8|M3XUH8_MUSPF) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLCH1 OC=Mustelinae; Mustela.
Sequence
MSYWNLEKRNCVQYRRHFLVDNSVFHVERCMSVMQSGTQMIKLKRGSKGLVRLFYLDEHR
TRLRWRPSRKSEKAKILIDSIYKVTEGRQSEIFHRQAEGHFDPSCCFTIYHGNHMESLDL
ITSNPEEARTWITGLKYLMAGISDEDSLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIH
QLMHKLNVNLPRRKVRQMFQEADTDENQGTLTFEEFCVFYKMMSLRRDLYLLLLSYSDKK
DHLTVDELAQFLKVEQKMSNVTTEYCLDIVRKFEVSEENKAKNVLGIEGFTNFMRSPACD
IFNPLHQEVYQDMDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCW
DGPDGEPVVHHGYTLTSKILFRDVVETINKHAFVKNEFPVILSIENHCSVQQQRKIAQYL
KGIFGDKLDLSSVDTGETKQLPSPQSLKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEI
EDECKFKLHYNNGTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLKATHEGLNA
HLKQHPDVKENGKRSHGRSLMTNFGKHKQKTTKSRSKSYSTDDEEDTQQNPGKETSQLYR
LGRRRKTMKLCRELSDLVVYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIY
NQKQLTRIYPSAYRIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAKFKTNGNCGYV
LKPQQMCKGTFNPFSGDPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEI
IGLPVDCCKDQTRVVDDNGFNPVWEETLTFTVHMPDIALVRFLVWDHDPIGRDFVGQRTV
TFSSLVPGYRHVYLEGLTEASIFVHITINEIYGKNRQLQGLKGLFNKNPRHGSSENNSHY
VRKRSIGDRILRRTASAPAKGRKKSKMGFQEMVEIKDSVSEASRDQDGVLRRTTRSLQER
PVSLPVDKSLLGALSLPISATAKDTEGKEHSLAEDKDGRRKGKASIKDQHLPNFNKKLSS
SSSALLHKDINQGDSTISVANTPITGEQLGVAGPKGGRTKANVSGDGQEQECPSRFLSPR
QHLALDPTVTLTQGPCGVKTKANGNAGGFAEEKSTLSGNIFSQSSLEIKNLEGSWITGRA
ATSFSLSDVSVLCSDIPDSHSTAIQQESEISHLIDNVTLTNENEPGSSISALIGQSEETS
DQANLTVVSQPPSTTVTSSHPSLPTLEQKMPFRHDFSMGKSKSSFLCSSPAPIAFSSPET
SKHSTHTDCETTCTPVSKAKPDDMLPGQSKTGAVENDLHGSYTSHCWLPKSPTNGKEWET
LKNHSPSTSTDLALGEVIAETTLSLNSGESSLVEVDGDSENLSITTYEYRREDTSHSASP
LKPEYGQDVVEHFQRRLRNGYRKETFPPSVSEILNNIQDVKNQSISCLAYPGAGFLHNCS
NLDTKVNQTCGPLSSDEGMHAPAPRQPTHPPLPALKLPSPCKSKSLGDLTSEDIACNFES
KYQCISKSFVTTGIRDKKGVTTKTKSLEPIDALTEQLRKLVSFDQEEGCQVLYSKPDASH
FPRALVRKLSSRSQSRVRNIASRAKEKQEANKQKVVNPSHAGGVVLRNKPSAPLPAGNRH
STGSYIAGYLRSSKAGGLEGHGIPEGACAALRPGYGDPFCSDHSILQTEPNSEDKPEIYF
LLRL
Download sequence
Identical sequences M3XUH8
XP_012913201.1.14098 ENSMPUP00000002728 ENSMPUP00000002728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]