SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XUN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XUN2
Domain Number 1 Region: 464-649
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.93e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 329-409
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000392
Family WWE domain 0.0038
Further Details:      
 
Weak hits

Sequence:  M3XUN2
Domain Number - Region: 238-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00973
Family CCCH zinc finger 0.006
Further Details:      
 
Domain Number - Region: 266-320
Classification Level Classification E-value
Superfamily WWE domain 0.0373
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XUN2
Sequence length 657
Comment (tr|M3XUN2|M3XUN2_MUSPF) TCDD inducible poly(ADP-ribose) polymerase {ECO:0000313|Ensembl:ENSMPUP00000002782} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TIPARP OC=Mustelinae; Mustela.
Sequence
MEMETTEPEPDCVVQPPSPPDGFSCQMRLSEKITPLKTCFKKKEQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSADESSLHEPIVKKPLEISPSCPPAENSMSVLIPDGTSVGGQ
IPEAHPSTDAPEQVVPIQDHSFPPETLSGTVADSTAGHFQTDLLHSVSSDVPASPDCIDK
VMDYIPGVFQDNSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVSTDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFTLLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWIYMHPSQDFIQVPVSVEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
Download sequence
Identical sequences M3XUN2
XP_004755676.1.14098 ENSMPUP00000002782 ENSMPUP00000002782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]