SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XV00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XV00
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 488-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 138-185
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 387-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 429-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000195
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 263-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000105
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 8 Region: 12-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000275
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XV00
Sequence length 544
Comment (tr|M3XV00|M3XV00_MUSPF) Zinc finger protein 333 {ECO:0000313|Ensembl:ENSMPUP00000002900} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZNF333 OC=Mustelinae; Mustela.
Sequence
MPNETLNPGAGVMESVTFEDVAAGLIQEWALLDGARRKLCRYVILDKCGTLAPRDWASQL
KSKALTPVQDILEENLSQDMQMGLKAAVQIQRVAMPVPALGVPELGMAGDSALLAQDPAW
LQKESTEEEAGAPAVLITCLQEPVTFADVAVLFTPEEWMFLDSAQRSLYRDVMLENYRNL
ASVGAGDQLGKPSTLSLSEPGEDLWAPERRTFPGTHPEPQHQPQDSVSHPDNFAEIPSTR
MKREQPQTGDKLYNYSELGEPFHGIRPLFQYQRIHTGGDPCECHEGGKSFFQPAHLIVPD
KIRRGDKTYVCSKCEKSFRYSSDLIRHEKTHTAEKCFECQECRQAFKYSSNLRRHLRTHT
GEKPFECAQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHTGEKP
FGCSQCGKAFREHSSLKTHLRTHTREKPYACNQCGKPFRTSTHLNVHKRIHTGEKLYECA
TCGQVLSRLSTLKSHMRTHTGEKPYVCQECGRAFSEPSSLRKHARTHTGKKPYACQECGR
AFVC
Download sequence
Identical sequences M3XV00
ENSMPUP00000002900 ENSMPUP00000002900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]