SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XV13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XV13
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000244
Further Details:      
 
Domain Number 2 Region: 403-439
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000706
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XV13
Sequence length 443
Comment (tr|M3XV13|M3XV13_MUSPF) Enah/Vasp-like {ECO:0000313|Ensembl:ENSMPUP00000002913} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=EVL OC=Mustelinae; Mustela.
Sequence
MATGEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQ
VVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGG
PSTQRQVQNGPSPEEMDIQRRQVMEQQHQQQRQESLERRTSAAGPILPPGHPSSAASAPL
SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGAQGA
SHDESSVSGLAAALAGAKLRRVQRPEDASGGSSPSGTSKSDTNRASSGGGGGGLMEEMNK
LLAKRRKAASQTDRPADKKEDESQAEEPSTSPSPGTRAASQPPNSSEAGRKPWERSNSVE
KPVSSLLSRTPSVAKSPEAKSPLQAQPHARMKPVGSVNDVALDALDLDRMKQEILEEVVR
ELHKVKEEIIDAIRQELSGISTS
Download sequence
Identical sequences M3XV13
ENSMPUP00000002913 ENSMPUP00000002913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]