SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVG5
Domain Number 1 Region: 383-445
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-22
Family LIM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 442-504
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.52e-19
Family LIM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 501-563
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.81e-18
Family LIM domain 0.0035
Further Details:      
 
Domain Number 4 Region: 355-381
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000653
Family LIM domain 0.0057
Further Details:      
 
Domain Number 5 Region: 560-589
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000989
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XVG5
Sequence length 590
Comment (tr|M3XVG5|M3XVG5_MUSPF) Paxillin {ECO:0000313|Ensembl:ENSMPUP00000003065} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PXN OC=Mustelinae; Mustela.
Sequence
VLSADALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWDPSASRFIHQQPQSPSPVCGSSAKTSSASVPQDGAGPPCSRAGEEEHVYSF
PNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPH
YGIPENNSSLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKIQGLEQMADGEAWAAGWPPSDRQ
SSPEGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGAC
KKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCN
GPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCAR
AILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKP
ITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
Download sequence
Identical sequences M3XVG5
ENSMPUP00000003065 ENSMPUP00000003065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]