SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVM1
Domain Number 1 Region: 281-447
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.19e-65
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000231
Further Details:      
 
Domain Number 2 Region: 38-104
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000168
Family U-box 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XVM1
Sequence length 522
Comment (tr|M3XVM1|M3XVM1_MUSPF) Peptidylprolyl isomerase like 2 {ECO:0000313|Ensembl:ENSMPUP00000003121} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PPIL2 OC=Mustelinae; Mustela.
Sequence
MGKRQHQKDKMYITCAEYTHFYGGKKPDIPQANFRRLPFDHCSLSLQPFAYPVCTPEGVV
FDLLNIVPWLKKYGTNPSNGEKLDGRSLIRLNFAKNKEGKYHCPVLFTVFTNNTHIVAVR
TTGNVYTYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSDFFHVKNNMK
MTDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEVLAATMKVPEKKKVDKLNAAH
YSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDMT
PKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSH
TGRGILSMANSGPNANKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTAMENVESDPKTD
RPKEEIRIDSTTVFVDPYEEADAQIAEERKKTQLEEAAPESAIKTQQPKAGSQGPQTYRQ
GVGKYINPAATKRAAEEEPSTSTAAPAAKKKPSRGFGDFSSW
Download sequence
Identical sequences M3XVM1
ENSMPUP00000003121 XP_004742584.1.14098 ENSMPUP00000003121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]