SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVQ4
Domain Number 1 Region: 589-957
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.62e-125
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 87-187
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-17
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XVQ4
Sequence length 959
Comment (tr|M3XVQ4|M3XVQ4_MUSPF) Oxysterol-binding protein {ECO:0000256|RuleBase:RU003845} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=OSBPL6 OC=Mustelinae; Mustela.
Sequence
MSSDEKGISPAHKTSTPTHRSASSSTSSHRDSRQSIHVLERTASSSTEPSVSRQLLEPEP
VPLSKEADSWEIIEGLKIGQTNVQRPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSK
APLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHR
LYRQNEIVRSPRDASFHIFPSTSTAESSPAANVSVVDGKVPPNNFPWQSPLPCSNSLPAT
CTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQAN
CVDISKKDKRVTRRWRTKSVSKDTKIQLQEGPSAKGQFSTTRRRQRLAAAVATTVPFSAT
MSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNS
IAIEKEKLKQMVSEQDHNKGHSTQMARLRQSLSQALNQNAELRSRLNRIHSESIICDQVV
SVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENEASDD
ESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNIL
RNNIGKDLSKVSMPVELNEPLNTLQHLCEEIEYSELLDKASETDDPYERMVLIAAFAVSG
YCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIR
WKNKFWGKSMEILPVGTLNVMLPKYGDCYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTK
SSVCICKLTFVKVNYWNSNVNEVQGVVMDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRP
GSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAAAEKQRV
EELQRSRRRYMEENNLEHIPKFFKKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
Download sequence
Identical sequences M3XVQ4
ENSMPUP00000003154 XP_004769039.1.14098 ENSMPUP00000003154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]