SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVQ5
Domain Number 1 Region: 731-1006
Classification Level Classification E-value
Superfamily RNI-like 8.63e-61
Family 28-residue LRR 0.0035
Further Details:      
 
Domain Number 2 Region: 7-83
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000612
Family Caspase recruitment domain, CARD 0.0057
Further Details:      
 
Domain Number 3 Region: 105-184
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000565
Family Caspase recruitment domain, CARD 0.0049
Further Details:      
 
Domain Number 4 Region: 267-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000557
Family G proteins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XVQ5
Sequence length 1013
Comment (tr|M3XVQ5|M3XVQ5_MUSPF) Nucleotide binding oligomerization domain containing 2 {ECO:0000313|Ensembl:ENSMPUP00000003155} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NOD2 OC=Mustelinae; Mustela.
Sequence
MCTQEAFQAQRGQLVGLLVSGSLEGFESILDWLLSWEVLSWEDYEGLSLLGQPLSHLARR
LLDTVWNKGTWGCEQLIAAIQEAQTDYQARELSSCWDPHSPHPARDLQSHRPAIVRRLHG
HVEGVLDLAWEHGFISQYECDEIRLPIFTSSQRARRLLDLATVKANGLAAFLLRHVQKLP
VSLALPFEDAACKKYMSKLRTTISAQSRFLSTYDGAENLCLEEIYTENVLEIRTERGPAG
LPQKSPVTLGLEELFGTRGHLNEEADTVLVVGEAGSGKSTLLQQMQLLWASGRDFQEFLF
VFPFSCRQLQCVAKPLSVQTLLFEHCCWPDLGQQEVFQFLLDHPNRVLLTFDGFDEFKFR
FSDRERHCSPTDPTSVENLLFNLLQGNLLKNARKVLTSRPDAVSALLRKYLRLELHLKGF
SEEGIELYLRKCHREPGVADRLVRLLKATSPLHGLCHLPVVSWMVSKCHQELLLHGGGSP
KTTTDLYLLILQHFLLHASPPDSVPCGLAPGLLQGRLPSLLHLGRLAVWGLGTCCYVFSD
KQLQAAHIDSEDISLGFLVHAKSVVQGGTAPLEFLHITFQCFFAALYLVLSADLSPSLLR
QLFSCHGPHSSLLARLLPPMCVPRSEHQEGSTAALLQEAEPHNLQITAAFLAGLLSREHQ
GLLAGSQVSEKALLQRQACARSCLSRSLHKHFHSIPPAVPGEAKSMHAMPGFIWLIRSLY
EMQEERLAREAVRGLKVGHLKLTFCGVGPAECAALAFVLRHLRHPVALQLDHNSVGDVGV
EQLLPCLNVCKALYLRDNNISDRGVCKLVERALHCEQLQKLALFNNKLTDGCAPSMARLL
SCKRNFLALRLGNNHITATGAQVLAEGLRANASLEFLGLWGNKVGDEGAQALAEALGDHQ
SLRWLSLVGNNIGSTGAQALALMLEKNVALEELCLEENRLQDEGVCSLAEGLEKNSSLKI
LKLSDNSITYFGAEALLRALERNDTILEVWLRGNTFSAEEVERLGQRDTRLLL
Download sequence
Identical sequences M3XVQ5
XP_004744216.1.14098 ENSMPUP00000003155 ENSMPUP00000003155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]