SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVU5
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000801
Family SH3-domain 0.002
Further Details:      
 
Domain Number 2 Region: 651-965,1078-1206
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000995
Family Armadillo repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XVU5
Sequence length 1869
Comment (tr|M3XVU5|M3XVU5_MUSPF) Dedicator of cytokinesis 5 {ECO:0000313|Ensembl:ENSMPUP00000003195} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DOCK5 OC=Mustelinae; Mustela.
Sequence
MARWIPTKRQKYGVAIYNYNASQDVELSLQIGDTVHILEMYEGWYRGYTLQNKSKKGIFP
ETYIHLKEATVEDRGQHETVIPGELPLVQELTSTLREWAVIWRKLYVNNKVTLFRQLQQM
TYSLIEWRSQILSGTLPKDELAELKKKVTAKIDHGNRMLGLDLVVRDDNGNILDPDETST
IALFKAHEMASKRIEEKIQEEKSVLQNLDLRAQSVFSAVHTYGLYVNFKNFVCNIGEDAE
LFMALYDPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSTDLIRPRISLVCQI
VRVGHMELKEGKKHTCGLRRPFGVAVMDITDIIHGKVDDEEKQHFIPFQQIAMETYIRQR
QLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKLLPGDLTQVQKNFSHL
VDRSTAIARKMGFPEIILPGDVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVYDEEGKLL
EKAIHPGAGYEGISEYKSVVYYQVKQPCWYETVKVSIAIEEVTRCHIRFTFRHRSSQESR
DKSERAFGVAFVKLMNPDGTTLQDGRHDLVVYKGDNKKMEDAKFYLTLPGTKVEMEEKEL
QASKTLANFTPSKDSTKDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKKLMEV
DGGEIVKFLQDTLDALFNIMMEMSDNETYDFLVFDALVFIISLIGDIKFQHFNPVLETYI
YKHFSATLAYVKLSKVLNFYVANADDSSKTELLFAALKALKYLFRFIIQSRVLYLRFYGQ
SEDGDEFNNSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLF
CKFIQSIPDNQLVRQKLNCMTKIVESNLFRQSECRDVLLPLLIDQLSGQLDDNSSKPDHE
ASSQLLSNILEVLDRKDVGPTAMHIQLIMERLLRRINRNVIGMSRQSPHIGSFVACMIAI
LRQMDDSHYSHYISTFKTRHDIIDFLMETFIMFKDLIGKNVYAKDWMVMNMTQSRVFLRA
INQFTEVLTKFFMDQASFELQLWNNYFHLAVAFLTHESLQLETFSQAKRNKIVKKYGDMR
KEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNFSG
NGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHCRKHKYLATSGEVFAFLVSSL
LEHLLDYRTIIMHDESKENRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHRDSENYTEA
AYTLLLHAELLQWSDKPCVPHLLQRDSYYVYTQQELKEKLYQEIISYFDKGKMWEKAIKL
SKELAETYESKVFDYEGLGNLLKKRASFYENIIKAMRPQPEYFAVGYYGQGFPSFLRNKI
FIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQYMQCFTVKPVMSLPPS
YKDKPVPEQILNYYRANEVQQFRYSRPFRKGEKDPDNEFATMWIERTTYTTAYTFPGILK
WFEVKQISTEEISPLENAIETMELTNEKISNCVQQHAWDRALSVHPLSMLLSGIVDPAVM
GGYSNYEKAFFTEKYLQEHPEDQEKIELLKRLIALQMPLLTEGIRIHGEKLTEQLKPLHD
RLSSCFRELKEKVEKLYGVITLPPTLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVI
STSSNSSDNAPSRPGSDGSVLEPLLERRASSGARVEDLPLKEDSENRISKFKRKDWSLSK
SQVIAEKASEPDLMSPARKAQRPKSLQLSDNRLTPFHGSSPPQSTPLSPPPLTPKATRTL
SSPSLQTDGLMTTTVPPPPPPKSKPYESGQRNSAEIAPPLPVRREAQCPPPPPPKARKSG
FLASEPGSH
Download sequence
Identical sequences M3XVU5
XP_004763306.1.14098 ENSMPUP00000003195 ENSMPUP00000003195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]