SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVX3
Domain Number 1 Region: 647-775
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000374
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XVX3
Sequence length 951
Comment (tr|M3XVX3|M3XVX3_MUSPF) Coiled-coil and C2 domain containing 1A {ECO:0000313|Ensembl:ENSMPUP00000003223} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CC2D1A OC=Mustelinae; Mustela.
Sequence
MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGVNDEELEAEFLALVGGQPQVLE
KLKGKGPLPMEAIEKMASLCMRDPDEGEDEGTDEEDVEADDDLLAELNEVLGEEQKTVES
HPPATQPKATAPSPGVEATLQERLALYQTAIESARRAGDGAKMRRYDRGLKTLENLLASV
RKGNTIDEGDIPPPVAVGKGPAATPCHTPTPTQPSSAHQPVPEPRVTVEGLPASAPTTSI
SLTKPQLPPGPCSPGPLAQLQSRQREYKLAALHAKQQGDTVTAARHFRVAKSFDAVLEAL
SRGEPVDLSRLPPPPDQLPPDPPSPSPQPPTPTTVPSTPEVPPPPRTLLEALEQRMERYH
VAAAQAKAKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQGLEATEP
TQQSLVGVLETAMKLANQDEGQEDEEDEEPRKPTSPPTPAAQPKAPPSRATPSGSTPAAK
TAPKGTSTRAQQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNG
LPVDIAKVPPAPVNKDDFSLVQRPGPGLSQDSARRYGELTKLIRQQHEMCLNHSNQFTHL
GNIAETSKFEKLAEDCKRSMEILKQAFARGLPTPTARFEQRTFSVIKIFPDLSSNDMLLF
IVKGINLPTPPGLSPSDLDVFVRFDFPYPNVEEAQKDKTSVVKNTDSPEFKEQFKLCINR
SHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALETACEVREILEVLDGRRPT
GGRLEVMVRIREPLTAQQLETTTERWLVVDPVPAAVPTQVAGPKGKAPPVPAPAREPGNR
SARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIVQRSQWQRAQLEQGGPG
IRREYAAQLERQLQFYTEAARRLGNDGSREAAKEALYRRNLVESELQRLHR
Download sequence
Identical sequences M3XVX3
ENSMPUP00000003223 ENSMPUP00000003223 XP_004748327.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]