SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XVX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XVX4
Domain Number 1 Region: 184-278
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 108-159
Classification Level Classification E-value
Superfamily L27 domain 4.71e-21
Family L27 domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XVX4
Sequence length 303
Comment (tr|M3XVX4|M3XVX4_MUSPF) Lin-7 homolog B, crumbs cell polarity complex component {ECO:0000313|Ensembl:ENSMPUP00000003224} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LIN7B OC=Mustelinae; Mustela.
Sequence
XXXXXXXXXXXXXXXRGAAVCGCGRVRGLSGPRSGAHRTALPVCVWGSGGAGLRPQSPLP
PATLRVSYWDSAVFPGICQCSPLLGFWPHRSVLIRVSDSVSAPRPRPADVSRAVELLERL
QRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTA
SEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVN
GVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLE
SRG
Download sequence
Identical sequences M3XVX4
ENSMPUP00000003224 ENSMPUP00000003224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]