SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XW27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XW27
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 101-149
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-20
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 3 Region: 346-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-17
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 4 Region: 239-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000991
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XW27
Sequence length 407
Comment (tr|M3XW27|M3XW27_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000003277} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSNQGRGALAVFLSSHFAGYGSTPNRSAGACIAVKGPASGNCPIGSGGRDPALSDACLRA
PRAGAQLPRAGRGVPSAQRPLDPAALPRGGVLESTERSPEMDLVIFEDVAVDFTLEEWAL
LDSMQRNLYRDVMLETFQNLVSVDYETLFKASGLVSQQDTLEKKKSIEQKMAKFTRNHSC
AYVLEKNWEDDSTKDQHGNHARHQRNPATDRFCESKERNQHRGTCSQLPHFNFCKNISTG
VKLYECTKCGKGFMHLSSLKRHVRSHCGQKPHLCQEHQQACICGTCLRTHTGKKPYGCKL
CGKTFPYFYSLTQHIRMHTPERNYECKQCGKTFQEFSSLTRHVKTHTGEKPYKCKECGKA
FMYPSIFQRHVVTHTEERPYECKLCRKAFHHSYSLTQPMKIHTSGKT
Download sequence
Identical sequences M3XW27
ENSMPUP00000003277 ENSMPUP00000003277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]