SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XWQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XWQ2
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-27
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XWQ2
Sequence length 700
Comment (tr|M3XWQ2|M3XWQ2_MUSPF) Nitric oxide synthase 1 adaptor protein {ECO:0000313|Ensembl:ENSMPUP00000003502} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NOS1AP OC=Mustelinae; Mustela.
Sequence
VLLSLLPLQYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYR
IFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQH
TQQNADGQEDGESERNSSSSGDPGRQLPGAERASSATAEETDIDAVEVPLPGNDILEFSR
GVTDLDAVGKEGGSHPDPKASPHPPEPMLAASPRMLLPSCSAKPPGLGPGTPLSSHHQMQ
LLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDLLQHISLLVK
QVQELELKLSGQNAMGSQDSLLEITFRSGGLPVLCDPTTPQPEDLPSPPPGAGLAELAHP
ASSPLGRRDCLVKLECFRFLPPPAGPLLGGLELLKFRESGIASEYESNTDESEERDSWSQ
EELPRLLNVLQRQELGDSLDDEIAVLDHGMFENVNAAHAPKLQPSCSFPHLSRLAAPSSA
APGSGVWVGSSQHLKNLGRAVGAKVNDFLRRKEPSSLDGAGAMEINRTAGARLAGGVPGQ
EARSALPDAFPRLDPPPPITRKRTPRALKTTQDMLISSQPVLSSLEYGTELSPGQPQDPL
PTAPPEAPLEVVDKGEALPNGEVSVSVPDLIHQDGQDEPKPKMTECRRASSPGLLERNGL
KLSLSRPDLAEPLEDGSSPPRARTSSLDNEGPHPDLLSFE
Download sequence
Identical sequences M3XWQ2
ENSMPUP00000003502 ENSMPUP00000003502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]