SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XWR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XWR9
Domain Number 1 Region: 176-359
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-55
Family Nuclear receptor ligand-binding domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XWR9
Sequence length 366
Comment (tr|M3XWR9|M3XWR9_MUSPF) Peroxisome proliferator activated receptor delta {ECO:0000313|Ensembl:ENSMPUP00000003519} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PPARD OC=Mustelinae; Mustela.
Sequence
MEQLPGEAPEIREEEEKKEVAEAEGTPELNGGPERSLPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCVALGMSHNAIRFGRMPEAEKRKLVAGLTASEGNQHNPQVADLKAFSK
HIYNAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQYTTVETVRELTEFAKSIPSFSNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGG
PGIILY
Download sequence
Identical sequences M3XWR9
ENSMPUP00000003519 ENSMPUP00000003519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]