SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XX06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XX06
Domain Number 1 Region: 6-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.98e-58
Family BAR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 242-435
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XX06
Sequence length 759
Comment (tr|M3XX06|M3XX06_MUSPF) Rho GTPase activating protein 44 {ECO:0000313|Ensembl:ENSMPUP00000003606} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGAP44 OC=Mustelinae; Mustela.
Sequence
MFLNFLFRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGAEADKRSKKLP
LTTLAQCLVEGSAILGDDTLLGKMLKLCGEAEDKLAQELIHFELQVERDVIEPLFLLAEV
EIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSGLQPAGAKADALREEMEEAANRV
EICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLALLQAVLPQIKAQQEAWVEK
PSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLKKLKAALDCCV
VDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKL
PKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNITEMMTTVSLQI
VGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPADRRQPEQARR
PLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTSWVARRGSSAGRKASCAPPTMQPPAPPA
ELAAPLPSPLPEQPLDGPAVPSLSPSGLGLQPGAERTSTAKSKELSPGSGQKGSPGSSQG
TPGAGTQPGPQAGPSPSQPPPDQSPHTLRKVSKKLAPIPPKVPFGQPGAVTEQSAGQPSP
LSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAAPPLASPAGFTSSAAKARPTPKPRQR
PTLPPPQPPTVSLPAPSPQSTEHPVLDGMAPGESMSTAV
Download sequence
Identical sequences M3XX06
ENSMPUP00000003606 ENSMPUP00000003606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]