SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XX26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XX26
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-17
Family THAP domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XX26
Sequence length 313
Comment (tr|M3XX26|M3XX26_MUSPF) THAP domain containing 7 {ECO:0000313|Ensembl:ENSMPUP00000003626} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=THAP7 OC=Mustelinae; Mustela.
Sequence
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPDVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPAALPASPTGRLEAGLSSPFSDLLG
PLGAQADEAGCSAQPSPEREPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGS
ALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLNKLQQERAREKRAQADARQTLKEH
VQDFAMQLSSSMA
Download sequence
Identical sequences M3XX26
XP_004742621.1.14098 ENSMPUP00000003626 ENSMPUP00000003626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]