SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XX53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XX53
Domain Number 1 Region: 390-570
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.8e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 257-356
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000392
Family WWE domain 0.0097
Further Details:      
 
Weak hits

Sequence:  M3XX53
Domain Number - Region: 68-91
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00053
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 186-223
Classification Level Classification E-value
Superfamily WWE domain 0.0222
Family WWE domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XX53
Sequence length 593
Comment (tr|M3XX53|M3XX53_MUSPF) Poly(ADP-ribose) polymerase family member 12 {ECO:0000313|Ensembl:ENSMPUP00000003653} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PARP12 OC=Mustelinae; Mustela.
Sequence
KNCRNNHSLTTDHNLSVLRTHGVDHLSYSELCQLLFQNDPWLLPEICLHYNKGDGPYGSC
SFQKQCIKLHICQYFLQGECKFGTSCKRSHDISNAENLEKLERLGMSSDLVSRLPSIYRN
AHDIKNRSSTTSRGHPPTLGPQGTSERRDSSGSVSPNTSNQEESDQICLYHIRKSCSFQD
KCNKVHFHLPYRWQFLDRGKWKDLDKMELIEEAYSNPRKDRILCAESASNFHFDCLDFES
MMFGAAPARRLSTASSVTKPPHFILTTDWVWYWTDEFGSWQEYGQQGLEHPVTTVSSSDL
EKAYLAYCAPGSDAQAAVLKFQAGKHKYELDFKVFVQKNLVYGTVRKVCRRPRFVSPQEV
KVKQACSVKFQGPKSIPDHWDPSALPDPGFKKITLSSSSDEYQKVWSLFNRTLPFYFVQK
IERVQNLALWEVYQWQKGQMQKRNGGKVVDERQLFHGTSANFVDAICQQNFDWRVCGLHG
TSYGKGSYFARDAAYSHHYSKSDTKLHTMFLARVLVGEFIRGNASFVRPPAKEGLGNVFY
DSCVNSMSDPSIFVVFEKHQVYPEYVIQYTGSTKPTTGASALFSLASFFGGRQ
Download sequence
Identical sequences M3XX53
ENSMPUP00000003653 ENSMPUP00000003653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]