SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XXA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XXA3
Domain Number 1 Region: 620-915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-73
Family Protein kinases, catalytic subunit 0.000000747
Further Details:      
 
Domain Number 2 Region: 98-256
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.04e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XXA3
Sequence length 924
Comment (tr|M3XXA3|M3XXA3_MUSPF) Discoidin domain receptor tyrosine kinase 2 {ECO:0000313|Ensembl:ENSMPUP00000003703} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DDR2 OC=Mustelinae; Mustela.
Sequence
MLLASHPGPVPANSVMNWIEVVRNHVLNVPEGFAVQGNPALWKVESYSVTWSLSQRFMSS
APVPAPSSELTPVPRMPLVLLLLLPLLSSVKAQVNPAICRYPLGMSGGHIPDEDITASSQ
WSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHG
IEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTD
HSMNVCMRVELYGCVWLDGLVSYSAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQ
LTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESAPSGYIEIMFEFDRIRNFTTMKVHCNNM
FAKGVKIFKEVQCYFRSEANEWEPNAVSFPLVLDDVNPSARFVTVPLHHRMASAIKCQYH
FADTWMMFSEITFQSDAAMYNNSGALPTSPVAPTTYDPMLKVDDSNTRILIGCLVAIIFI
LLAIIVIILWRQFWQKMLEKASRRMLDDEMTVSLSLPSESSMFNNNRSSSPSEQESNSTY
DRIFPLRPDYQEPSRLIRKLPEFAPGEEESGCSGIVKPAQPSGPEGAPHYAEADIVNLQG
VTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDK
DFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITDDPLC
MITEYMENGDLNQFLSRHEPPSSASSNAPTVSYANLKFMATQIASGMKYLSSLNFVHRDL
ATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVW
AFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAVCPDSVYKLMLSC
WRRDTKHRPSFQEIHLLLLQQGDE
Download sequence
Identical sequences M3XXA3
ENSMPUP00000003703 XP_004751473.1.14098 ENSMPUP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]