SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XXF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XXF2
Domain Number 1 Region: 201-328
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-30
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 332-433
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-25
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 6-65
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000413
Family PDZ domain 0.019
Further Details:      
 
Domain Number 4 Region: 112-163
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000517
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XXF2
Sequence length 1748
Comment (tr|M3XXF2|M3XXF2_MUSPF) FERM and PDZ domain containing 3 {ECO:0000313|Ensembl:ENSMPUP00000003752} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FRMPD3 OC=Mustelinae; Mustela.
Sequence
MAGSERPMVVRSVRPGGPSEDKLLAGDQILAINEEDVSEAPRERFIELIRSAKEFIVLTV
QHTHQSPKSAFISAAKKARLRLNPAKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLE
NGQIKSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYAGPEQNHKFLLLQDKQPLAY
VVQRTHYQGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLL
GLTALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKEKNLRKSLSQQLKAHQ
THPSSGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRHGISHVID
LKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGYC
RLLLDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVPGGHLGKKESSYVGSVGTSPRKSS
RSTPPPADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYD
VIPDDFDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSCKAKLQEQLGPRKGGRPGSS
RDNMVDLMSLPPPGSEEVEEEEDESTSLLPAIAAPPPGFRDNSSDEDDPKRRAVQSQEQG
RHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEALAASEDGPHPQPPQTA
GLIVLATITPESSLDSGHETNSSELTDMSEMVSAMKQHQNTTYFLAQHLNKESLLARKDL
PFRIQSCAAQAVLTAPYSLGRPDPNPALQPAVTGQSPGPPGARRKLPPSESQPPQRERAY
ALAVHPALTPQLSEQKNLSLLSPVPEDKGPGHARAGLEMSLRAATPSLSEEQVSELRENL
PKEVRLSPKLILDPKGSVTPAIISAALQQVVHPKSLPAPSGAIVTPPSSGERRLEASMGR
PEVSMGRSEVSMMGGSANKNLKFKMSPGAPETSRNSQQPLSPEVSSGSRAPTGSRADSLH
LSPQEDRLPGQSFPPKSYLSRANRESLSKQCIGEVAGKAGPEGAKPALHKPAAISSQGEK
GQLESVPQGSKIEETSLVPRASYSMALPSPSGQSRGHSPSSQSRGQSPSYQSRGQSPSYQ
PRGQSPSYQPRGQSPLRPQAASRQVSTMPSRKLETTLDRGHSASEGPTKPKSSRGPFRLR
NLFSATFPTRQKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGPEYLQPPAPGRCS
CQLRSSPVQQGPGMSREQRRSCDCKRICRGGRPQAPQTPVPGLRGRERDRLPPTQRQPEA
GPGLSLGSPTNAGRLRSTSLESRECRSDPESGMSCLTTCASGGECLGAHNYRKLMRRYSI
SELDQGDRASLTSDIYPHPPLGMLPREPKEVEAGLPLGLGPKTKSLESPTLGDPSYVQVA
PETKGPRQMAVFSLPEEVYQKPADLDEDSESGKCCSIRYCFYYRKCDMADDASDGKDELS
YSIPMKILPGMKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKI
NALRAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKE
LRASCRRVANVDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVV
RNYTFLLRAAEESTTRNLSQQQQQQQQQQQQQQQAVAAVSAATGHPPGSPTSATVMSTFT
RSLKTLIK
Download sequence
Identical sequences M3XXF2
ENSMPUP00000003752 XP_012920316.1.14098 ENSMPUP00000003752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]