SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XXG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XXG4
Domain Number 1 Region: 189-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-84
Family Nuclear receptor ligand-binding domain 0.00000000338
Further Details:      
 
Domain Number 2 Region: 136-217
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-30
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XXG4
Sequence length 463
Comment (tr|M3XXG4|M3XXG4_MUSPF) Retinoid X receptor gamma {ECO:0000313|Ensembl:ENSMPUP00000003764} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RXRG OC=Mustelinae; Mustela.
Sequence
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
PPLNALGSPYRVITSAMGPPSGALPAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSASPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASGGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences M3XXG4
XP_004751493.1.14098 XP_012910998.1.14098 ENSMPUP00000003764 ENSMPUP00000003764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]