SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XXR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3XXR3
Domain Number - Region: 25-102
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00785
Family BAR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XXR3
Sequence length 779
Comment (tr|M3XXR3|M3XXR3_MUSPF) Zw10 kinetochore protein {ECO:0000313|Ensembl:ENSMPUP00000003864} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZW10 OC=Mustelinae; Mustela.
Sequence
MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCTMISKKYSEFLPSMQSAQDLV
TQVDKLSEDIDLLKSRIESEVRRDLHVSTAEFTDLKQQLERDSVVLSLLKQLQQFSAAIE
EYNCALTEKKYVTAAQCLEEAQKCLKLLKSRKCLDLKMLKSLSMELTIQKQNILYHLGEE
WQKLIVWKFPPSKDTSNLESCLQTELHLCIEQSQKEEKTPVPPISSVLLAFSILGELQMK
LKSFGQMLLKYILRPLASCPSLHAIIESQPNIIIIRFESVMTDLEHPSPSEVFVKIRLVL
EMLQKQLLDLPLDTDLENEKTPKIVLAEMLGDVVWEDLSECLIKNCLVYSIPTNSSKLQQ
YEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIH
NTVKITPDSKVSVPDLPRPEEDEKPEVQKMSTTQYNEVVNLEPENTLDQHSFSLPTCRIS
ESVKQLMELAYQTLLEAITSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAI
HHNNCMYIAHHLLTLGHQFRSRFAPILCDGTTTFVDLVPGFRRLGTECFLGQMRAQKGEL
LERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTA
ISEIIGRITVLEDISTEDADRLYSLCKTVMDEGPQVFAPLSEESKNKKYQEEVPVFVPKW
MPFKELMMILQASLQEIGDRWADGKGPLAAAFSSSEVRALIRALFQNTERRAAALAKIK
Download sequence
Identical sequences M3XXR3
XP_004749914.1.14098 ENSMPUP00000003864 ENSMPUP00000003864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]