SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XY02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XY02
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily PDZ domain-like 2.29e-18
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XY02
Sequence length 252
Comment (tr|M3XY02|M3XY02_MUSPF) GIPC PDZ domain containing family member 3 {ECO:0000313|Ensembl:ENSMPUP00000003953} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GIPC3 OC=Mustelinae; Mustela.
Sequence
MSVVINSGLPLPLGQILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTED
ALGLTITDNGAGYAFIKRIKEGSIINRVQAVCVGDSIEAINDHSIVGCRHYEVAKMLREL
PKSQPFTLRLVQPKRAFDMISQRSRGSKCPTEAKMASGRETLRLRSGGAATVEEMPSEFE
EEASRRVDDLLESYMGIRDPELAATMVDTSKKTRSVQEFAHRLDSVLGEFAFPDEFVVEV
WAAIGEAREACG
Download sequence
Identical sequences M3XY02
ENSMPUP00000003953 ENSMPUP00000003953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]