SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XY73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XY73
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-32
Family PWWP domain 0.00000798
Further Details:      
 
Domain Number 2 Region: 347-426
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 6.41e-30
Family HIV integrase-binding domain 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XY73
Sequence length 531
Comment (tr|M3XY73|M3XY73_MUSPF) PC4 and SFRS1 interacting protein 1 {ECO:0000313|Ensembl:ENSMPUP00000004024} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PSIP1 OC=Mustelinae; Mustela.
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAIDITTPKAARRGRKRKAEKQIETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDMVTEEDKSKKKGQEEKQPKKQLKKDEDGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQESEKKRKGGRNFQNPHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDSNQPQHNGDSSEESKDNHEASSKKKSSSEERETERETLKDSTLDN
Download sequence
Identical sequences M3XY73
ENSMPUP00000004024 XP_004765779.1.14098 XP_004765780.1.14098 ENSMPUP00000004024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]