SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XY93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XY93
Domain Number 1 Region: 22-193
Classification Level Classification E-value
Superfamily RUN domain-like 9.94e-34
Family RUN domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XY93
Sequence length 1019
Comment (tr|M3XY93|M3XY93_MUSPF) RUN and cysteine rich domain containing beclin 1 interacting protein {ECO:0000313|Ensembl:ENSMPUP00000004044} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RUBCN OC=Mustelinae; Mustela.
Sequence
MRPEGAGMELGGCEERLPEESRREHWQLLGNLKTTVEGLVSANSPNVWSKYGGLERLCRD
MQSILYHGLIHDQQVCCRQTDYWQFVKDIRWLSPHSALHVEKFISLHENGESGADGESGD
SDSRRAVAELWLQHSLQRHCLSAQLRPLLGDRQYIRKFYTDTAFLLSNAHVTAMLQCLEA
VEQNNPRLLAQLDASMFARKHESPLLVTKSQSLTALPGSTCTTSTSYAQHPYFGSFSSLH
QSAPNHSSERRTTSFSLSGPPRKPQESKEHVSPARDQTFQAPLLAVSSLAGDPPSTPNEM
SSSTLTSPLEASQVSNQNESPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLF
SSSSSQKPDSAASSLGEQEGGGQSQLSSILRRSSFSEGQTLTATSGTKKSHTRSHSDTNI
ASRGAPGGPRNITIIVEDPIAESCNDKSKLRGPLPYSGPSSEVSTPSSLYMEYEGGQYLC
SGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLE
EEEEEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQETEHGTGFRVTSSSSQFSSRDST
QFSDSGSADEVDEFEIQDGSEGSNLTHMSKNGLSVSMASMFSDADIRRSTASNSKSFTSS
QSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPD
DGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYI
KRLRYCEYLGKYFCQCCHENAQMVIPSRVLRKWDFSKYYVSNFSKDLLIKIWNDPLFNVQ
DINSALYRKVKLLNQVRLLRIQLYHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLN
DLTATRKGELGPRLAELTKAGAAHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCE
ECKACYHKACFKSGSCPRCERLQARRELLAKQSLESYMSDYEEEPTEALALEATVLEAT
Download sequence
Identical sequences M3XY93
ENSMPUP00000004044 ENSMPUP00000004044 XP_004745431.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]