SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XYL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XYL7
Domain Number 1 Region: 460-543
Classification Level Classification E-value
Superfamily DEATH domain 3.01e-20
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XYL7
Sequence length 545
Comment (tr|M3XYL7|M3XYL7_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000004168} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSSDRSWRCCLTWRRLCGWCCFGSKEEPARELNYKSGRGRKAVLPLSLLSLPFPRSDSGY
CEESLSSTFKTSNNSSQVCPSSESEELLTGEPTLHIPPGLLSWWSGGFHETRALVVTSLR
RRVPGSSKSADQESSQTQESEETCLEEKTLVPLEAPKLFSGVGPACHSYQFLGPEGNVDI
ELIDESANRYSVHFPMAGFYLWPTTRLGFLVTAAVTVRIALDSWSLHMKLQHEKQWMVAG
PLFDISVEPEGVIAEIHLPHIISLPANEVDMSWFHVAHFKDEGMVLEPPARVECFYAVLE
NPSFSLMGILLRLASGARVSVPITSTALLYYHFYPEDTKFHLYLIPSDSLLTKAIDEEET
KFHGVRLQTSPPVEPLNFGSRYIVSGSAHLEIMPEELKLSYRSPGEIQVFSKVFAGKMEE
PIILEVTDKRHKTLVWRTLVKPVELQFYAASPPSPLSAEAFMKENHRHLQARLGDLSGVL
DDLQDSGVFTEEEKELVQQFPTRQRKNETLLRMVEKKGPQALEIFFRSLQQRDPYLMSYL
SQQSL
Download sequence
Identical sequences M3XYL7
ENSMPUP00000004168 ENSMPUP00000004168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]